PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00064098001
Common NameGSBRNA2T00064098001, LOC106381231
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family LBD
Protein Properties Length: 261aa    MW: 29631.9 Da    PI: 5.2891
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00064098001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF2601261.9e-39361351100
               DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleql 90 
                          aCaaCk++rrkCa+dC lapyfp++++++f n+hklFG+sn++k++k+l++ ++++am +++++++ara+dP++G++++i+klq q+e +
  GSBRNA2T00064098001  36 ACAACKYQRRKCAPDCLLAPYFPHDRHRQFLNAHKLFGVSNITKIIKDLSPPDKDAAMYTIMFQSDARANDPIEGCYSIIRKLQYQIEYS 125
                          7***************************************************************************************** PP

               DUF260  91 kaelallkee 100
                          k+el+++ ++
  GSBRNA2T00064098001 126 KNELDMVIQQ 135
                          ****988776 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089124.85935136IPR004883Lateral organ boundaries, LOB
PfamPF031953.4E-3636132IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 261 aa     Download sequence    Send to blast
MPSGKPSSSV FSLHPKPTPL KPSSSTTSNN NTTNQACAAC KYQRRKCAPD CLLAPYFPHD  60
RHRQFLNAHK LFGVSNITKI IKDLSPPDKD AAMYTIMFQS DARANDPIEG CYSIIRKLQY  120
QIEYSKNELD MVIQQLAVFR NHHQEPHIQI QEPEDLSSFS SSCDLNNNNS ITYNYPLHHV  180
QEPVQQQQEQ QQYCASGNFN GLQEDMWCLQ LQDSSTTVNM KGGFIDECED VKPVEEVSSE  240
THEFEQHHDG FVEEPYIISS *
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00064098001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013676575.10.0PREDICTED: LOB domain-containing protein 22-like
SwissprotQ9LRW11e-147LBD22_ARATH; LOB domain-containing protein 22
TrEMBLA0A078HKV40.0A0A078HKV4_BRANA; BnaC01g37390D protein
STRINGBra021513.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM64982645
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13850.11e-140LOB domain-containing protein 22
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]